SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015419521.1.95426 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015419521.1.95426
Domain Number 1 Region: 24-135
Classification Level Classification E-value
Superfamily FAD-dependent thiol oxidase 4.58e-40
Family FAD-dependent thiol oxidase 0.000000679
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_015419521.1.95426
Sequence length 136
Comment PREDICTED: LOW QUALITY PROTEIN: FAD-linked sulfhydryl oxidase ALR [Myotis davidii]; AA=GCF_000327345.1; RF=representative genome; TAX=225400; STAX=225400; NAME=Myotis davidii; AL=Scaffold; RT=Major
Sequence
MDVRPQGWLCLNLAPKRGSKFREDCPQDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMA
QLIHLFSKFYPCEECAEDIRKRXVTLNQPDTRTRASFTQWLCRLHNEVNRKLGKPDFDCS
KVDERWRDGWKDGSCD
Download sequence
Identical sequences XP_015419521.1.95426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]