SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015463492.1.101067 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015463492.1.101067
Domain Number 1 Region: 253-320
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 2.49e-32
Family Small-conductance potassium channel 0.0000208
Further Details:      
 
Domain Number 2 Region: 122-293
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.23e-29
Family Voltage-gated potassium channels 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_015463492.1.101067
Sequence length 339
Comment PREDICTED: small conductance calcium-activated potassium channel protein 2 isoform X2 [Astyanax mexicanus]; AA=GCF_000372685.1; RF=representative genome; TAX=7994; STAX=7994; NAME=Astyanax mexicanus; AL=Scaffold; RT=Major
Sequence
MFGIVVMVIETELSWGAYGKESLYSLALKCLISLSTIILLGLIIIYHAREIQLFMVDNAA
DDWRIAMTYERIFFICLEILVCAIHPIPGKYTFTWTARLAFYYTSSKTDADVDIILSIPM
FLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFTISLW
IIAAWTVRACERYHDNQDVTSNFLGAMWLISITFLTIGYGDMVPNTYCGKGVCLLTGIMG
AGCTALVVAVVAKKLELTKAEKHVHNFMMDTQLTKRVKNTAANVLRETWLIYKNTKLVRK
MDHARVRKHQRKFLQAIHQYVSTAPTQPCRVRVLCVSLL
Download sequence
Identical sequences XP_015463492.1.101067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]