SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015472254.1.82291 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015472254.1.82291
Domain Number 1 Region: 1-120
Classification Level Classification E-value
Superfamily Rap30/74 interaction domains 3.66e-40
Family Rap30/74 interaction domains 0.000000476
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_015472254.1.82291
Sequence length 120
Comment PREDICTED: general transcription factor IIF subunit 1-like [Parus major]; AA=GCF_001522545.2; RF=representative genome; TAX=9157; STAX=9157; NAME=Parus major; AL=Chromosome; RT=Major
Sequence
MERDMSNKRIYAEEELPESGAGSEFHRKLREEARRKKYGIVLREFRAEDQPWLLRVNGKT
GRKFRGVKKGGVTENASYYVFTQCPDGAFEAFPVRNWYNFTPLARHRTLTAEEAEEEWER
Download sequence
Identical sequences XP_015472254.1.82291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]