SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015510304.1.5119 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015510304.1.5119
Domain Number 1 Region: 117-251
Classification Level Classification E-value
Superfamily Phospholipase A2, PLA2 3.93e-29
Family Insect phospholipase A2 0.0000947
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_015510304.1.5119
Sequence length 256
Comment PREDICTED: phospholipase A2-like [Neodiprion lecontei]; AA=GCF_001263575.1; RF=representative genome; TAX=441921; STAX=441921; NAME=Neodiprion lecontei; AL=Scaffold; RT=Major
Sequence
MARGAILALILVGLAKTKRVLAQQEYSATSSLVDEDYTDNAIDLVPTTTSSLEDFLLTIS
NPFRIFNRPEDQLDRNTERFFLGLPPGIREVFFAGRSITQNGFGQVMNQYRKRIQAIFPG
TRWCGTGDVARSPNDIGIFSLTDTCCRTHDACPEYVLAGSSNRGLKNNGIFARSHCSCDE
EFYQCLKNTHTLIAKKIGITYFDVLQPQCFKLEYPIKRCLRFTSFPGTKRCVLYEFDTSG
NKTWQWFDNAHFLGHF
Download sequence
Identical sequences XP_015510304.1.5119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]