SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015516690.1.5119 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015516690.1.5119
Domain Number 1 Region: 74-174
Classification Level Classification E-value
Superfamily Phospholipase A2, PLA2 0.00000000000000471
Family Insect phospholipase A2 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_015516690.1.5119
Sequence length 207
Comment PREDICTED: group XIIA secretory phospholipase A2 [Neodiprion lecontei]; AA=GCF_001263575.1; RF=representative genome; TAX=441921; STAX=441921; NAME=Neodiprion lecontei; AL=Scaffold; RT=Major
Sequence
MRFTKYRKIFVYILTFSTYVWSDYGADILGNLRDAVLAAETIFGDFFKNAVTVAKKFKDV
HEVINAAADDSCVYTCPTGMIPKPNWNHKPQSNGCGSLGLEQAQEFFSFPEVTSCCNAHD
ICYDTCNNDKEKCDFEFKRCLYKYCDSFESSSTSMIKACRTAAKVLFSGTTTLGCKSFLD
AQSNACYCKDRQNTKYKETKRGAQAGG
Download sequence
Identical sequences XP_015516690.1.5119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]