SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015631955.1.37577 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015631955.1.37577
Domain Number 1 Region: 422-798
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 1.05e-118
Family Oxysterol-binding protein 0.00068
Further Details:      
 
Domain Number 2 Region: 90-121,148-227
Classification Level Classification E-value
Superfamily PH domain-like 7.87e-20
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 
Weak hits

Sequence:  XP_015631955.1.37577
Domain Number - Region: 38-49
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.000178
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_015631955.1.37577
Sequence length 804
Comment PREDICTED: oxysterol-binding protein-related protein 1C isoform X2 [Oryza sativa Japonica Group]; AA=GCF_001433935.1; RF=representative genome; TAX=39947; STAX=4530; NAME=Oryza sativa Japonica Group; AL=Chromosome; RT=Major
Sequence
MHPFCCVPPVPVSPAASAAAAATPAASSAVAGAPAVMPPPPPPLPPPPPRSNSAPPERRA
LRWAAGGGSGGGNSPPEGVKLNEIVGGGISGILYKWVNYGRGWRPRWFALHDGVLSYYKI
HGPDRIVLSRETERGAKVIGEDSLRRLSRPSTSSSSSAHSNGHHLPRKPIGEIHLKVSSV
RESRSDDRRFSIFSGTKRLHLRAETREDRAAWVEALQATKEMFPRMSTSEMVGPGDTAAA
VAVSTERLRQRLQQEGVSEAAIADSERIVRTEFEVLHKQLMLLKQKQTLLLDTLRQLETE
KVDLENTLVDESQRQSKEYGSTSRSKNEKYSEGSASESDDYNEPQDPAEDETDDDENIYF
DTRDFLSSSSFKSSGSDFQRSEAGSDDEDDYPMDGIDTSMKSVGISYPYVRRRKKLPDPV
EKEKGVSLWSMIKDNIGKDLTKVCLPVYFNEPLSSLQKCFEDLEYSYLIDRAYEWGKRGN
SLMRILSVAAFAVSGYASTDGRSCKPFNPLLGETYEADYPDKGLRFFSEKVSHHPMVVAC
HCEGTGWRFWADSNLKSKFWGRSIQLDPVGVLTLEFDDGEVFQWSKVTTSIYNLILGKLY
CDHYGTMRIQGNNEYSCKLKFKEQSIIDRNPHQVQGVVQDRSGRTVATLFGKWDESMHYV
MGDCFGKGKGSENFSEAHLLWKRSKPPKFPTRYNFTRFAITLNELTAGLKEKLPPTDSRL
RPDQRCLENGEYERANAEKLRLEQRQRQARKMQESGWKPRWFAKDKATDTYRYLGGYWES
REKGSWEGCPDIFGQVPNDLMITD
Download sequence
Identical sequences A0A0E0GSH7 A0A0E0P066 Q8LN57
LOC_Os03g49770.1|13103.m05411|protein LOC_Os03g49770.1|PACid:21914301 XP_015631955.1.37577 39947.LOC_Os03g49770.1 ONIVA03G32500.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]