SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015746836.1.37977 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015746836.1.37977
Domain Number 1 Region: 16-74
Classification Level Classification E-value
Superfamily Phenylalanine zipper 5.36e-20
Family Adapter protein APS, dimerisation domain 0.0017
Further Details:      
 
Domain Number 2 Region: 189-249
Classification Level Classification E-value
Superfamily PH domain-like 0.0000307
Family Pleckstrin-homology domain (PH domain) 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_015746836.1.37977
Sequence length 249
Comment PREDICTED: SH2B adapter protein 3-like, partial [Python bivittatus]; AA=GCF_000186305.1; RF=representative genome; TAX=176946; STAX=176946; NAME=Python bivittatus; AL=Scaffold; RT=Major
Sequence
MNGHAVPSGDPLRPSGWNEFCERHAITTARELARKYLHFVSENPQHEVLAAENFSVQFAD
LFQQYFRNEVKDNFTMNPFRILPFSRVRDYRETGQKHAEGSAGTVGTKVEVELSDQVDRG
SEARPRGLPKSWSSEELAGPTSSSAVRRHFSLDRLRRSWRSLFRRRSSEPAPGEGEMADL
VLKSGLARKFFPWTVSQDLSSQVQKEGNLKYMMVMEDSGTRWQKCRLVLYKEGPSDRQNY
ALALFDPPK
Download sequence
Identical sequences XP_015746836.1.37977

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]