SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015791043.1.93521 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015791043.1.93521
Domain Number 1 Region: 114-221
Classification Level Classification E-value
Superfamily Phospholipase A2, PLA2 4.15e-30
Family Insect phospholipase A2 0.00084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_015791043.1.93521
Sequence length 251
Comment PREDICTED: phospholipase A2-like [Tetranychus urticae]; AA=GCF_000239435.1; RF=representative genome; TAX=32264; STAX=32264; NAME=Tetranychus urticae; strain=London; AL=Scaffold; RT=Major
Sequence
MLSTSLIISLVSLVSLVNANLHNIVYSTDSKSKLVYISVDDSATSLEKAIVNCSVFSEPD
AVNGVLSSTTDPVIPIDEDSFNTLVKTCNGLKPSSILSLEPLTNIFDLASDLLIAPGTKY
CGPGNRSSSYDDLGRRVELDKCCRAHDNCPMSIGGFQSKYGLKNPQAYTSSRCDCDRELK
SCLKKASETDVEATLTGVIYFNILETKCFQQVEPEDQCLEYSGLLIKKCEKRADPNSTEP
VYQFQTSGLFP
Download sequence
Identical sequences T1KWF9
tetur24g01500 XP_015791043.1.93521

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]