SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_016063548.1.3490 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016063548.1.3490
Domain Number 1 Region: 96-206
Classification Level Classification E-value
Superfamily FAD-dependent thiol oxidase 1.44e-40
Family FAD-dependent thiol oxidase 0.000000707
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_016063548.1.3490
Sequence length 207
Comment PREDICTED: FAD-linked sulfhydryl oxidase ALR [Miniopterus natalensis]; AA=GCF_001595765.1; RF=representative genome; TAX=291302; STAX=291302; NAME=Miniopterus natalensis; AL=Scaffold; RT=Major
Sequence
MAASSERGRFGGGNLFSFLPGGARSEAMEDLVTDARGRGAGRKDPATASAPTPNLAPTPD
SQVAEDTSRRRHCRACVDFKSWMRTQQKRDSKYREDCPEDREELGRHSWSVLHTLAAYYP
DLPTPEQQQDMAQLIHLFSKFYPCEECAEDIRKRICRNQPDTRTRACLTQWLCRLHNEVN
RKLGKPDFDCSKVDERWRDGWKDGSCD
Download sequence
Identical sequences XP_016063548.1.3490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]