SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_016111179.1.42290 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016111179.1.42290
Domain Number 1 Region: 30-129
Classification Level Classification E-value
Superfamily Nucleoplasmin-like core domain 1.12e-28
Family Nucleoplasmin-like core domain 0.000098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_016111179.1.42290
Sequence length 148
Comment PREDICTED: nucleoplasmin ATPase-like [Sinocyclocheilus grahami]; AA=GCF_001515645.1; RF=representative genome; TAX=75366; STAX=75366; NAME=Sinocyclocheilus grahami; AL=Scaffold; RT=Major
Sequence
MTSCLIENDSVASISLSELSSSSSVSDRASVHWGCVLSGSETTAVFKAENDLLENQFFIK
TICLSEEAGDEMHIVAVCDGVGASKPLPVATLRHCMPMISFPGLELIPPVTFKLCSGKGP
VFISAQHITLNPIEMTEGEEEEDEDEDD
Download sequence
Identical sequences XP_016111179.1.42290 XP_016111180.1.42290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]