SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_016165976.1.73718 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016165976.1.73718
Domain Number 1 Region: 1-78
Classification Level Classification E-value
Superfamily N-terminal, heterodimerisation domain of RBP7 (RpoE) 8.24e-19
Family N-terminal, heterodimerisation domain of RBP7 (RpoE) 0.0024
Further Details:      
 
Domain Number 2 Region: 79-158
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000702
Family Cold shock DNA-binding domain-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_016165976.1.73718
Sequence length 196
Comment DNA-directed RNA polymerase III subunit RPC8 isoform X2 [Arachis ipaensis]; AA=GCF_000816755.2; RF=representative genome; TAX=130454; STAX=130454; NAME=Arachis ipaensis; cultivar=K30076; AL=Chromosome; RT=Major
Sequence
MFYLSKIEHTLPLPAPQLSRPIREAIHTELEKLFLDKVIANLGLCVSVYDIKSIEGGFIY
PGDGAPTYTVVFNLIMFRPFVGEIMTAKLLSSDADGLRLSLGFFDDIYVPLQHLPSPNEF
KAESKNSTKGTWYWKYEEQSYPVDDSDMIKFRIQNVTYPSIPVEQPKESKPFAPMLVTIF
EKVTYGSIYFVGINRS
Download sequence
Identical sequences XP_016165976.1.73718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]