SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_016421433.1.44103 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016421433.1.44103
Domain Number 1 Region: 18-172
Classification Level Classification E-value
Superfamily TRADD, N-terminal domain 2.22e-59
Family TRADD, N-terminal domain 0.00011
Further Details:      
 
Domain Number 2 Region: 196-288
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000000000113
Family DEATH domain, DD 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_016421433.1.44103
Sequence length 293
Comment PREDICTED: tumor necrosis factor receptor type 1-associated DEATH domain protein [Sinocyclocheilus rhinocerous]; AA=GCF_001515625.1; RF=representative genome; TAX=307959; STAX=307959; NAME=Sinocyclocheilus rhinocerous; AL=Scaffold; RT=Major
Sequence
MDSIDTKRLYDSNGNDGAFSGCAVLFLGSSSPAHNLLSLYKDEQGKFSLFKVIKLTLIDS
VGGLEGYEILKLHDADPFLGVELKFMAMPPCQRFLESYACGSLAQFLSQHASRLLTLPDG
VVMETQLKAGIHTLDQSLQDVEMCLEHIRQSQPVRLRDDEVTQLEQQLQNSFGPPSQPPQ
ELPRNCFLFQKRVFDDRPLTSADQQRFAAHVGREWKRVGRALQKNCRALKGPAIDNLAYE
YEREGLYEQAYQLLGRFIQSEGRSAKLSRLISALEETKLTSMAEIMLGIQPRD
Download sequence
Identical sequences XP_016421433.1.44103 XP_016421434.1.44103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]