SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_016609530.1.7107 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016609530.1.7107
Domain Number 1 Region: 127-265
Classification Level Classification E-value
Superfamily ISP domain 3.8e-40
Family Rieske iron-sulfur protein (ISP) 0.00000302
Further Details:      
 
Domain Number 2 Region: 101-138
Classification Level Classification E-value
Superfamily ISP transmembrane anchor 0.00000632
Family ISP transmembrane anchor 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_016609530.1.7107
Sequence length 266
Comment cytochrome b-c1 complex subunit Rieske, mitochondrial [Spizellomyces punctatus DAOM BR117]; AA=GCF_000182565.1; RF=representative genome; TAX=645134; STAX=109760; NAME=Spizellomyces punctatus DAOM BR117; strain=DAOM BR117; AL=Scaffold; RT=Major
Sequence
MHSRTHWTQRVPSVVLKLIPTSFATSKKAHLPCVSDIAVKYYQVPELVSKTNFTAPLLFS
YQKRAFSSPVTKAAPDDDVIRPPQDQAKYIEPKYYYDEIAARNTRYLLVASFSVLGAVAA
KNIVTDYMENLAASADVLALAKVELDMGSVPEAKNVVVKWRGKPVFIRHRTADEIAEARS
VPLSELRDPEKDEDRVKKPEWLVMLGVCTHLGCVPIGEAGDYGGWFCPCHGSHYDISGRI
RKGPAPLNMEIPPYDFNEVDGKIVIG
Download sequence
Identical sequences A0A0L0HJ49
XP_016609530.1.7107 SPPG_03291T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]