SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_016661425.1.67334 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016661425.1.67334
Domain Number 1 Region: 4-60
Classification Level Classification E-value
Superfamily FAD-dependent thiol oxidase 3.14e-17
Family FAD-dependent thiol oxidase 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_016661425.1.67334
Sequence length 62
Comment PREDICTED: FAD-linked sulfhydryl oxidase ALR-like isoform X2 [Acyrthosiphon pisum]; AA=GCF_000142985.2; RF=representative genome; TAX=7029; STAX=7029; NAME=Acyrthosiphon pisum; strain=LSR1; AL=Scaffold; RT=Major
Sequence
MEHNCPLNRVQLGYHTWNLLHTMVANYPDEPSPQKQEDIYQFFKLLARLYPCQACGRDFS
HL
Download sequence
Identical sequences XP_016661425.1.67334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]