SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_016814684.1.37143 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016814684.1.37143
Domain Number 1 Region: 94-199
Classification Level Classification E-value
Superfamily Nucleoplasmin-like core domain 2.09e-33
Family Nucleoplasmin-like core domain 0.0000608
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_016814684.1.37143
Sequence length 226
Comment PREDICTED: nucleoplasmin-2 isoform X7 [Pan troglodytes]; AA=GCF_000001515.7; RF=representative genome; TAX=9598; STAX=9598; NAME=Pan troglodytes; AL=Chromosome; RT=Major
Sequence
MGWGGGARRPRRVRNWPGQLLTKGPGPASSASPGNWLELQIPSAPPRPTPRAAVEWGAAM
RPLTALQLPGQPASLPGAMNLSSASSTEEKAVTTVLWGCELSQERRTWTFRPQLEGKQSC
RLLLHTICLGEKAKEEMHRVEILPPANQEDKKMQPVTIASLQASVLPMVSMVGVQLSPPV
TFQLRAGSGPVFLSGQERYEKKAGKRRGGNKLGVVACACNPSYSGG
Download sequence
Identical sequences XP_016814684.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]