SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_016877924.1.92137 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016877924.1.92137
Domain Number 1 Region: 1144-1221
Classification Level Classification E-value
Superfamily Immunoglobulin 1.99e-18
Family I set domains 0.0093
Further Details:      
 
Domain Number 2 Region: 758-831
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000115
Family I set domains 0.049
Further Details:      
 
Domain Number 3 Region: 541-594
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000353
Family TSP-1 type 1 repeat 0.0031
Further Details:      
 
Domain Number 4 Region: 1039-1119
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000197
Family I set domains 0.037
Further Details:      
 
Domain Number 5 Region: 254-314
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000523
Family TSP-1 type 1 repeat 0.0019
Further Details:      
 
Domain Number 6 Region: 309-369
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000157
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 7 Region: 406-460
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000183
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 
Domain Number 8 Region: 1260-1318
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000314
Family TSP-1 type 1 repeat 0.0075
Further Details:      
 
Domain Number 9 Region: 594-654
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000405
Family TSP-1 type 1 repeat 0.0029
Further Details:      
 
Domain Number 10 Region: 650-715
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000103
Family TSP-1 type 1 repeat 0.0041
Further Details:      
 
Domain Number 11 Region: 1312-1379
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000111
Family TSP-1 type 1 repeat 0.004
Further Details:      
 
Domain Number 12 Region: 1434-1490
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000105
Family TSP-1 type 1 repeat 0.0063
Further Details:      
 
Domain Number 13 Region: 176-236
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000301
Family TSP-1 type 1 repeat 0.0056
Further Details:      
 
Domain Number 14 Region: 482-538
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000654
Family TSP-1 type 1 repeat 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_016877924.1.92137
Sequence length 1526
Comment PREDICTED: ADAMTS-like protein 3 isoform X5 [Homo sapiens]; AA=GCF_000001405.37; RF=reference genome; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Patch
Sequence
MCISGICQAVGCDRQLGSNAKEDNCGVCAGDGSTCRLVRGQSKSHVSPEKTPGLPPGQGG
PLPGGHLSAIYEWPILKGEENVIAVPLGSRSVRITVKGPAHLFIESKTLQGSKGEHSFNS
PGVFLVENTTVEFQRGSERQTFKIPGPLMADFIFKTRYTAAKDSVVQFFFYQPISHQWRQ
TDFFPCTVTCGGGYQLNSAECVDIRLKRVVPDHYCHYYPENVKPKPKLKECSMDPCPSSD
GFKEIMPYDHFQPLPRWEHNPWTACSVSCGGGIQRRSFVCVEESMHGEILQVEEWKCMYA
PKPKVMQTCNLFDCPKWIAMEWSQCTVTCGRGLRYRVVLCINHRGEHVGGCNPQLKLHIK
EECVIPIPCYKPKEKSPVEAKLPWLKQAQELEETRIATEEPTFIPEPWSACSTTCGPGVQ
VREVKCRVLLTFTQTETELPEEECEGPKLPTERPCLLEACDESPASRELDIPLPEDSETT
YDWEYAGFTPCTATCVGGHQEAIAVCLHIQTQQTVNDSLCDMVHRPPAMSQACNTEPCPP
RWHVGSWGPCSATCGVGIQTRDVYCLHPGETPAPPEECRDEKPHALQACNQFDCPPGWHI
EEWQQCSRTCGGGTQNRRVTCRQLLTDGSFLNLSDELCQGPKASSHKSCARTDCPPHLAV
GDWSKCSVSCGVGIQRRKQVCQRLAAKGRRIPLSEMMCRDLPGLPLVRSCQMPECSKIKS
EMKTKLGEQGPQILSVQRVYIQTREEKRINLTIGSRAYLLPNTSVIIKCPVRRFQKSLIQ
WEKDGRCLQNSKRLGITKSGSLKIHGLAAPDIGVYRCIAGSAQETVVLKLIGTDNRLIAR
PALREPMREYPGMDHSEANSLGVTWHKMRQMWNNKNDLYLDDDHISNQPFLRALLGHCSN
SAGSTNSWELKNKQFEAAVKQGAYSMDTAQFDELIRNMSQLMETGEVSDDLASQLIYQLV
AELAKAQPTHMQWRGIQEETPPAAQLRGETGSVSQSSHAKNSGKLTFKPKGPVLMRQSQP
PSISFNKTINSRIGNTVYITKRTEVINILCDLITPSEATYTWTKDGTLLQPSVKIILDGT
GKIQIQNPTRKEQGIYECSVANHLGSDVESSSVLYAEAPVILSVERNITKPEHNHLSVVV
GGIVEAALGANVTIRCPVKGVPQPNITWLKRGGSLSGNVSLLFNGSLLLQNVSLENEGTY
VCIATNALGKAVATSVLHLLERRWPESRIVFLQGHKKYILQATNTRTNSNDPTGEPPPQE
PFWEPGNWSHCSATCGHLGARIQRPQCVMANGQEVSEALCDHLQKPLAGFEPCNIRDCPA
RWFTSVWSQCSVSCGEGYHSRQVTCKRTKANGTVQVVSPRACAPKDRPLGRKPCFGHPCV
QWEPGNRCPGRCMGRAVRMQQRHTACQHNSSDSNCDDRKRPTLRRNCTSGACDVCWHTGP
WKPCTAACGRGFQSRKVDCIHTRSCKPVAKRHCVQKKKPISWRHCLGPSCDRDCTDTTHY
CMFVKHLNLCSLDRYKQRCCQSCQEG
Download sequence
Identical sequences XP_016877924.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]