SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_016909165.1.2121 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016909165.1.2121
Domain Number 1 Region: 145-244
Classification Level Classification E-value
Superfamily Phospholipase A2, PLA2 2.1e-31
Family Insect phospholipase A2 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_016909165.1.2121
Sequence length 261
Comment PREDICTED: uncharacterized protein LOC107995921 isoform X1 [Apis cerana]; AA=GCF_001442555.1; RF=representative genome; TAX=7461; STAX=7461; NAME=Apis cerana; strain=Korean; AL=Scaffold; RT=Major
Sequence
MSFTEWILFLIAAIISNSIQQPIFFKNTFKGLNGISKANMIDRNEIRAVYYHDQTVAVVD
LGINNELHNCNLIEVYEKNEANEVLRNLSSIVIPQLVSFSQMTKLIQQCELLDKMQHERL
STTISNSVNKDNHGMSNVLSLLSGILPGTKWCGAGDIAENYHDLGQEVQIDRCCRSHDLC
PVKIRAQQTRYNLTNYSVYTKSHCVCDEALYRCLKATTHPTAHIMGRIYFNIIKIPCIED
VPEKNTSIELGRQFIPVKMNY
Download sequence
Identical sequences XP_016909164.1.2121 XP_016909165.1.2121 XP_016909166.1.2121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]