SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_016937483.1.48971 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016937483.1.48971
Domain Number 1 Region: 4-112
Classification Level Classification E-value
Superfamily Nucleoplasmin-like core domain 3.27e-26
Family Nucleoplasmin-like core domain 0.0000576
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_016937483.1.48971
Sequence length 156
Comment PREDICTED: nucleoplasmin-like protein [Drosophila suzukii]; AA=GCF_000472105.1; RF=representative genome; TAX=28584; STAX=28584; NAME=Drosophila suzukii; AL=Scaffold; RT=Major
Sequence
MESESFYGVTLSEKEPIAQFDVPDIPEEYIVHSHKLIIKQISLGPEAKSGEFNVVQAETN
INDDGEKKTVKIPIAVLKVGETRSLRPNVEFPNGSVTFKLVQGTGPVYVCGKAEMNFGEF
DDGQIYEEYSDEEDDSELELDDEAAPQTNGKSKQKK
Download sequence
Identical sequences DS10_00008526 XP_016937483.1.48971 XP_016951450.1.21709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]