SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_016944125.1.48971 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016944125.1.48971
Domain Number 1 Region: 71-520
Classification Level Classification E-value
Superfamily Sema domain 1.31e-132
Family Sema domain 0.0000454
Further Details:      
 
Domain Number 2 Region: 1389-1518,1727-1888
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.43e-43
Family p120GAP domain-like 0.034
Further Details:      
 
Domain Number 3 Region: 882-976
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000255
Family Other IPT/TIG domains 0.0076
Further Details:      
 
Domain Number 4 Region: 975-1063
Classification Level Classification E-value
Superfamily E set domains 0.00000000000131
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.076
Further Details:      
 
Domain Number 5 Region: 523-574
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000301
Family Plexin repeat 0.0021
Further Details:      
 
Domain Number 6 Region: 1082-1164
Classification Level Classification E-value
Superfamily E set domains 0.00000011
Family E-set domains of sugar-utilizing enzymes 0.055
Further Details:      
 
Weak hits

Sequence:  XP_016944125.1.48971
Domain Number - Region: 1193-1242
Classification Level Classification E-value
Superfamily E set domains 0.00014
Family Other IPT/TIG domains 0.08
Further Details:      
 
Domain Number - Region: 836-869
Classification Level Classification E-value
Superfamily Plexin repeat 0.000209
Family Plexin repeat 0.0043
Further Details:      
 
Domain Number - Region: 670-706
Classification Level Classification E-value
Superfamily Plexin repeat 0.00903
Family Plexin repeat 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_016944125.1.48971
Sequence length 1945
Comment PREDICTED: plexin-A2 isoform X1 [Drosophila suzukii]; AA=GCF_000472105.1; RF=representative genome; TAX=28584; STAX=28584; NAME=Drosophila suzukii; AL=Scaffold; RT=Major
Sequence
MNFILSVLLIATLGDKYDHRLNLRAGSQTLAANIWSDKTAIQNESINMTDVNATVKDAKN
HSTTITNVAKFDTKLNHLLVDTITGRVFVGGVNRLYQLSPDLELSETVKTGPQNDSVECS
ILDCPLNAVRSPTDNYNKVLLIDRATSRLIACGSLFQGTCTVRNLQNVSIIEHEVPDAVV
ANDANSSTVAFIAPGPPQHPVTNVMYVGVTYTNNSPYRSEIPAVASRSLEKTKMFQIASS
AVTTGTRTFINSYARETYFVNYVYGFSSERFSYFLTTQLKHSHHSSPKEYITKLVRICQE
DSNYYSYTEIPVECISDAQGGTKFNLVQAGFLGKPSSDLAQSLGISIQDDVLFAVFSKGD
GNTPTNNSALCIYSLKSIRRKFMQNIKSCFNGNGMRGLDFISPSMPCVLTKLQTIGEDFC
GLDVNSPLGGENPITSVPVAMFNTKLTSVAATSTSGYTVVFVGTTDGYLKKVVVESSSVA
NEYASFPVDLGSAISQDMQFDNQNLYMYVMSETKVSKVKVFDCSDYKTCGECLGARDPYC
GWCSLENKCSPRSNCQDDANDPLYWVSYKTGKCTTITSVVPHQLQRTTARTLELIIDHLP
QLKENLICAFTTEDKALFTNATKKRNGVNCTTPRTDMLPQIEQGKHHFTAKLSVRTRNGP
DLVSTDFTFFDCSTHSSCTRCVSSEFPCDWCVEAHRCTHDTAENCRNDILVTGVSRIGPS
YRSGPGFCPTINATGDGSEVLVSGGTSKSIKVKVHIIGQFIVQTRFVCQFNIEGRVTSLN
AQLLGDTIYCDSMEFQYTSRSPNLTATFAVIWGGSKPLDNPHNIHVVIYRCREMADSCGI
CLALAEKYNCGWCSSTNTCEVEEQCNKNKEGKTDWLNRSEICPNPEIHTFEPKTGPWEGG
TNITIRGINLGKNYNDIYSGVRIAGINCMPFPQFYIDTKQIVCTVDSPGEQMYRNGKIVV
QIGDYRGESKEDYEFVDPKILDFNPKFGPTSGGTEIHITGKHLNAGSRIQASINDHLPCK
ILSTDSSQAICRTSPSPGIIEGRLKMSFDNGPREFNDYNFKYVLDPTIEHVSSGPSGQIK
VPKGIPAGGIRISVIGTQFTSIQTPNIYVVYNGEIYASQCRVQSDTEMECASPVIEVDSK
IIEAERPMLLEYGFLMDNVLRVQNLSKIHNNHFELYPNPEYFIFEERVKYFKSEYLTING
RNLDRACKETDVEVKIGNGFCNITSLSRQQLTCRPPPEATATKSINGPEVIVRIGTSLEY
RIGILSYESSNIILDWGENVIFAVIATIVILLLIFVALLVAYKKKSSESNRVLRNMQEQM
DILELRVAAECKEAFAELQTEMTDLTGDLTSGGIPFLDYRSYAMKILFPNHEDHIVLQWE
RPELLRKEKGLRIFGQLIMNKTFLLLFIRTLESNRYFSMRERVNVASLIMVTLQSKLEYC
TDILKTLLGDLIEKCIEGKSHPKLLLRRTESVAEKMLSAWFTFLLYKFLKECAGEPLYML
FRAVKGQVDKGPVDACTHEARYSLSEEKLIRQSIDFRPMNVYASIIQQPIFCNNLDMLPP
HTENVSVKVLDCDTIGQVKEKCLETIYKNIPSSQRPRKDDLDLEWRTGATGRVILYDEDV
TSKTESEWKKLNTLQHYNVPDGAGLSLVPKQSSIYNFSILSDKNEKSHKYETLNISKYTS
SSPTFSRAGSPLNNDMHDNGLRYWHLVKHHDSDMQKEGERVNKLVSEIYLTRLLATKGTL
QKFVDDLFETIFSTAHRGSALPLAIKYMFDFLDDQAQLHGITDPEVVHTWKSNSLPLRFW
VNLIKNPNFVFDIHKSNIVDSCLSVVAQTFMDSCSTSDHRLGKDSPSSKLLYAKDIPEYR
KWVDRYYRDIRDMSPISDQDMNAMLAEESRLHTTEFNTNCALHELYTYAVKYNEQLTVTL
EEDEFSQKQRLAFKLEQVHNIMSAE
Download sequence
Identical sequences XP_016944125.1.48971 XP_016944126.1.48971 XP_016944127.1.48971 DS10_00007072

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]