SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_016945935.1.48971 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016945935.1.48971
Domain Number 1 Region: 104-228
Classification Level Classification E-value
Superfamily ISP domain 8.4e-38
Family Rieske iron-sulfur protein (ISP) 0.00000265
Further Details:      
 
Domain Number 2 Region: 36-103
Classification Level Classification E-value
Superfamily ISP transmembrane anchor 1.16e-20
Family ISP transmembrane anchor 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_016945935.1.48971
Sequence length 230
Comment PREDICTED: cytochrome b-c1 complex subunit Rieske, mitochondrial [Drosophila suzukii]; AA=GCF_000472105.1; RF=representative genome; TAX=28584; STAX=28584; NAME=Drosophila suzukii; AL=Scaffold; RT=Major
Sequence
MMNAVSRAYVRGGAQALSSGLKASAVAVNSMANRQAHTDLQVPDFSPYRRESVKDSRRRN
ETAEERKAFSYLLVGAGAVGGAYAAKGLVNTFIGSMSASAEVLAMAKIEIKLADIPEGKS
VTFKWRGKPLFIRHRTAAEIETERGVATSTLRDPETDDQRVIKPEWLVVIGVCTHLGCVP
IANAGDWGGYYCPCHGSHYDASGRIRKGPAPLNLEVPTHEFPNEGLLIVG
Download sequence
Identical sequences DS10_00000759 XP_016945935.1.48971

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]