SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_017122702.1.32376 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017122702.1.32376
Domain Number 1 Region: 643-758
Classification Level Classification E-value
Superfamily Bromodomain 1.19e-31
Family Bromodomain 0.001
Further Details:      
 
Domain Number 2 Region: 513-626
Classification Level Classification E-value
Superfamily Bromodomain 1.2e-30
Family Bromodomain 0.00021
Further Details:      
 
Domain Number 3 Region: 195-301
Classification Level Classification E-value
Superfamily Bromodomain 5.1e-27
Family Bromodomain 0.0014
Further Details:      
 
Domain Number 4 Region: 34-158
Classification Level Classification E-value
Superfamily Bromodomain 5.1e-24
Family Bromodomain 0.0013
Further Details:      
 
Domain Number 5 Region: 373-451
Classification Level Classification E-value
Superfamily Bromodomain 7.59e-19
Family Bromodomain 0.0026
Further Details:      
 
Domain Number 6 Region: 1309-1381
Classification Level Classification E-value
Superfamily HMG-box 0.00000000000000524
Family HMG-box 0.0015
Further Details:      
 
Domain Number 7 Region: 767-872
Classification Level Classification E-value
Superfamily Bromodomain 0.00000000877
Family Bromodomain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_017122702.1.32376
Sequence length 1664
Comment PREDICTED: protein polybromo-1 [Drosophila elegans]; AA=GCF_000224195.1; RF=representative genome; TAX=30023; STAX=30023; NAME=Drosophila elegans; AL=Scaffold; RT=Major
Sequence
MLSRKRRASSISSRQDEDPLQLDDSTPEQSPVQQQTTTTTQSARKKRRLDPTELCQQLYD
SVRNIKKEDGSMLCDTFIRAPKRRQEPSYYDVVVNPIDLLKVQQKLKTDSYDDLDDLMAD
LELLIGNAKAFYKPDSCEHQDAVALWQHIQVQRQRIMEANGLATEEEPRARRISRQVRRM
TSSTEPGGGDSTAADDEYNQYEELFASIMTASDPVGDRAMHRMFQLLPSKKIYPDYYDVI
EHPIDLRLIATKIQMNAYSSLVEMERDLLQMTKNACLFNEPGSQIYKDAKALKRIFTQRR
IELETGKGKLAKRIKSLSSAAIAALKEEVDSSDDEETSKKGEGPMWALFDHLYNAPGTSE
HPGVTGPPLGNSLWKLPVRRFHPEYFELIKRPISMSQIHTKLKKGDYANISDLTADLYLM
LDNAKKAFPPSHRTHKDALKMLKLMNAKLVEESLEETSDLDEEDADDMDTEVFATNSQPE
RRKPGRPRVNSNSNSNASHTPNNSNSPKSNRIAINAAIKKKILSIQKYLVDYSLGNRRPI
EMFMEKPPRKIYPDYYDIIQNPIDMNTIEHNIRTDRYAAVEDVVSDYRLMFSNCRQYNEE
GSNIYEDANTLERALNEKLKEFPGLVEVKKPQQKYNKVGRKLKTALITERLWQFYETVRE
YQEPKGKRQLSLIFTKLPSKNEYPDYYDIIKEPIDMERIAQKLKQGAYESLDDLAADFLL
MLENACKYNEPDSQIYKDALVLQQLTLQLKQQLRTERDSLPDVPLAVQELFLTLFTTLYN
HQDEEGRCYSDSLAELPEYDELGEGPKVRGISLDLVKRRLDKGAYKRLDIYQEDIFACLE
RARKLSRTDSDVFQDSIELQTYFIRKRDELCKDTLSSPALSFTLERLLADVEVSRQQKVQ
QEEQDQEQEKEKEEFNAAKGESMTINQQVFSPGDYVYVQMPENKIPSIVCIERLWTSPTN
EKLMQASIFVRPHETYHVTTRKFLEKEVFKSSLSQTISMDKVLGMCYVMNIRDYIKMRPE
RLPEKDVFVCESRYNIQARCFKKLKSWPPIREGSSVKFVPREQPLELKRVMSVFKERLEK
HKGELEELKLQETLVEKEKPNVSCDPPANAEHSSTYYQQYNTVCSGAIKTGDFVYVATQT
GKQSVAQVQQIWEQNGKSYFKGPWLLPPSETPLPALGKQFYRQELLLSTVEEVSPVVGVV
GRCAVLEYSEFIGSRPTEISESDVYICESVYDELKKALRKLATGNLRKFQHSPAVTEDEI
FYFKTPIKPSKDVKNELNELGMLEDSMDGDTPSLSSDIAAMSSPAPSVNSTPLTSKVKAA
KSAKKCLTGYILYSSEVRKSICQSNPEASFGDISRMVGTEWKNLPSSVKQSWEDRASRQN
EETAAMRRELDDVQNSASPSPQVSQDGPGQVLTFECQWDKCDFQFEELADCTEHCMSDAT
GHIQRNPQAGMEIEYICLWRNCPRIKKSTQAFPNVLRLTKHVREVHLSKCGKPVAVADRS
KNFVPRRQKHASLAATTVPIPPSLAQSPRGPSNLDAVQMQQQQQQQQNVHQQMQPQTIVL
GPPPEPLFVTVPPRITRVIHSEAYIKYIESLQTGSHLNVATCNNSWRRALTHVTPAQVVA
KVGTPLPEQWIGPNLRDQGNVVQALCHLRNFMVDDVLQIRRSCN
Download sequence
Identical sequences XP_017122702.1.32376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]