SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_017211518.1.45394 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017211518.1.45394
Domain Number 1 Region: 533-801
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 3.54e-109
Family N-acetyl transferase, NAT 0.00000000046
Further Details:      
 
Domain Number 2 Region: 272-339
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.26e-16
Family PHD domain 0.0063
Further Details:      
 
Weak hits

Sequence:  XP_017211518.1.45394
Domain Number - Region: 224-286
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000115
Family PHD domain 0.021
Further Details:      
 
Domain Number - Region: 113-193
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000136
Family Linker histone H1/H5 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_017211518.1.45394
Sequence length 2246
Comment histone acetyltransferase KAT6A isoform X1 [Danio rerio]; AA=GCF_000002035.6; RF=reference genome; TAX=7955; STAX=7955; NAME=Danio rerio; AL=Chromosome; RT=Major
Sequence
MVKLANPLYTTWILEAIKKVKKQKQRPSEERICNAVSMSHGLDRKTVLEHLELSVKDGSI
LKVSNKGLNSYKDPDNPGRLSFPKPRAGGGGGGCGSGGGGGGGGGSSTSSSSKKPGLDWN
KLIKRSLEGLHEPGGSSLKSIERFLKCQADVAGYLSGSGSMGPGIFHQQLRLALKRACSH
GRVVKQGPLFRLVSRSSHDGTGCVSLDSLPPVRLLPHEQDRPVAEPIPICSFCLGTKEQN
RDKKPEELISCADCGNSGHPSCLKFSPELTVRVKALWWQCIECKTCSSCQDQGKNADNML
FCDSCDRGFHMECCDPPLTRMPKGMWICQICRPREKGRKLLHDKAAQIKRRYNAPLGRPK
GRPGRPFKKIRGGGRGRRRRGAGGVDQCSQGSSSPHSSSSSSCEGYPGDDRMLFSLREDD
SAHGSLRFNKKTKGLIDALSKFFTPSPDGRKARAEVVDYSQQYRMRKKGNRKGEHDDRTG
DNQECSDSWREDEDKLPGHENLTEKDVELFRHIQEIALQKVGVTGPPDPQMRCPSVIEFG
KYEIQTWYSSPYPQEYSRLPKLYLCEFCLRYMKSRSILYQHMRKCNWFHPPANEIYRKDD
VSVFEVDGNVSTIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVLTQNDNKGCHLVGYFSKE
KHCQQKYNVSCIMILPQYQRKGYGRFLIDFSYLLSKREGQPGSPEKPLSDLGRLSYMAYW
RSVVLECLHEIRDRQLSIRKLSKVTGICPQDITATLLNLNMLEQKGDGVIIMRREKLVAN
HMARLKAKPRLLEVDPDCLRWTPVIVTNTVVSEGEGDEDEEEEGEEERKEIKPSHKSSPL
SWHMKGERENEEEKQSFPAFPKNQSSPPSSSVCNNVLSPERHSNFLAANGERRGPGRPPK
NWLWGKVKDAPRTVPARPRKLKITGDEDDDDDDDDEVEDDDEEEEEEEEDERTGINKVTA
SPSLHSALENEPDSTSACPMEPSRHLTVPPQRNRGRPPRKKRGPKRRLGEEPGDDLPLLP
NNTRLSEPLPVSPAYMSESSEDEEDEEEESRPRSPPILTKPTLGLKSKSQKSLRKRRVRQ
RSHPHSSVVTETISETTEVLDEPFVDSDSERPMPRLEEETPFGTPLRCYTAARKHMGPAL
KSISRSNLSESEEDDPTPVLKPIAVLRRPETSDATQRTEETSEMPEVPVKKKKGWPKGKS
RKPLHWKKRPGRKPGSGAGQTDDTDLAVPSSEDPPPSKIKMKPGRKPRSYYLQRAQEEEV
QQEFEQSQLTSQQQQQQQQQQQQQQAQTDNLAQEEKACKRTARALISEISPEKQKDSEDD
DDDFLQGFRESSRPKKRGRPPKNANLPSTVPKPPPLSEPEEEDEEEDRWTEEKLSRPPSR
TMSQSSSSRVPQPRANTNMADAEEDEERDDEDCNNRVSRKTATTPGSGSRRSDDHDADDE
GDGRLEEKSDSSSSSKRRKGQDSEDDAEEQEDEEDEEPPSPAHTPPVKEEPQSSESFLDM
QTNVARDYVSKQEDGDEDEDDAEAVQEVKNNSADTDERRRREQEESAAAAAAVETVTAIA
DPSEPMDMQPLHVEDKTVLMMGAEHSHQHPDFKDDLSHQQHTHHHSSELDLETVQAVQSL
TQGEAQEEDAESHEAYQDCEETLAACRTLQSYSHTGEGEEETLALVEECGASQHSPMPNP
PMPTLPNQSVRSVNSPALTPGPMEPGPGVSGPTGTGGGTGGGYTQITPEHPSSLSAPSLQ
NMETSPMMDVPSVSDHSQQVVDSGFSDLGSIESTTENYDNPSSYDSTMGGGGNGGGNGSN
GGGMSAATAAAVAASSTSSSSSSSSATPSSSSSQGNSCSFVSTPGLTSSSTGVGSQISMG
SCSLIQQTGPGTTNGPGSNSTGGVPQPPPPPPPTSASTPTCGIKSPQGCVIERPPSANQQ
QQKKVSQPPQQQQNPQPQPPPSAPPPPPPQQQALSQCSMGNGFASMPMIMEIPESAGSGG
GGRSLYDRMGQDFGAGGYSLAKLQQLTNTIMDPHGMSYSHSAAVTSYATSVSLSNPGLAQ
LASSPHPPLGQAQPTMTPPPNLGSGSMNLGSPLIQCNMTGANIGLPPTPHPQRLQGQMAT
VKGHIAIRSKASQIPAGSPHQQQLYSRSSGAVTMQGSPRTLVQRGMMTNLMPTPAAYNSV
NMNPLNAAMSAGYRMSQPMMNSGYHSNPPYMNQPAQYPMQMQMGMMGGQAYPQQPMQPNH
HGNMMYTGPSHHSYAGVPKQSPYMSR
Download sequence
Identical sequences A2CG09
ENSDARP00000014581 NP_001116784.4.45394 XP_017211518.1.45394 XP_017211519.1.45394 ENSDARP00000014581

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]