SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_017426856.1.48467 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017426856.1.48467
Domain Number 1 Region: 78-175
Classification Level Classification E-value
Superfamily FAD-dependent thiol oxidase 7.59e-37
Family FAD-dependent thiol oxidase 0.0000331
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_017426856.1.48467
Sequence length 196
Comment PREDICTED: FAD-linked sulfhydryl oxidase ERV1 isoform X2 [Vigna angularis]; AA=GCF_001190045.1; RF=representative genome; TAX=3914; STAX=3914; NAME=Vigna angularis; cultivar=Jingnong 6; AL=Chromosome; RT=Major
Sequence
MPVNPLQVLFQNFEQVSNFVQHHLSNFVGPHLQSSGLPGSGFPLSVSSSTKAPLAKTTSS
VQLGDTAVKVKSTTQGPKEELGRATWTLLHTLAAQYPDKPTRQQKKDVKELVQILSRMYP
CRECADHFKEILRANPVQTGSHTEFSQWLCHVHNVVNRSLGKPVFPCERVDARWGKLECE
QKACEIIGSTSFFGKI
Download sequence
Identical sequences XP_017426841.1.48467 XP_017426849.1.48467 XP_017426856.1.48467 XP_017426864.1.48467

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]