SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_017483599.1.95384 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017483599.1.95384
Domain Number 1 Region: 135-271
Classification Level Classification E-value
Superfamily ISP domain 1.21e-38
Family Rieske iron-sulfur protein (ISP) 0.00000403
Further Details:      
 
Domain Number 2 Region: 80-146
Classification Level Classification E-value
Superfamily ISP transmembrane anchor 9.16e-16
Family ISP transmembrane anchor 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_017483599.1.95384
Sequence length 273
Comment PREDICTED: cytochrome b-c1 complex subunit Rieske, mitochondrial-like [Rhagoletis zephyria]; AA=GCF_001687245.1; RF=representative genome; TAX=28612; STAX=28612; NAME=Rhagoletis zephyria; AL=Scaffold; RT=Major
Sequence
MLNVFAFGIKKAIFRAFLQRQNAFQFILRRHREKTVNTFQTLAETAAARGAHIKTVHMIS
LFKSTALPFPPLSQSLRLLHNDMNVPDFSDYRRETTNPDDPHDNCAEQRKAFSYMMVAAG
VIGSCYAAKGIVNMFVRSMGVSADVLAMAQIEIKLKDIPEGKSVTFKWRGKPLFIRHRTE
AEIQDVRSVKISTLRDPESDDKRVKDPHWLVVIGVCTHLGCVPIANAGDFGGYYCPCHGS
HFDASGRVRKGPAPLNLEVPQYAFLDEHTLIVG
Download sequence
Identical sequences XP_017481422.1.95384 XP_017483599.1.95384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]