SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_017505222.1.32401 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017505222.1.32401
Domain Number 1 Region: 21-127
Classification Level Classification E-value
Superfamily SRCR-like 2.09e-46
Family Scavenger receptor cysteine-rich (SRCR) domain 0.000066
Further Details:      
 
Domain Number 2 Region: 264-372
Classification Level Classification E-value
Superfamily SRCR-like 7.46e-43
Family Scavenger receptor cysteine-rich (SRCR) domain 0.000059
Further Details:      
 
Domain Number 3 Region: 390-499
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.53e-34
Family Spermadhesin, CUB domain 0.00041
Further Details:      
 
Domain Number 4 Region: 148-260
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.9e-33
Family Spermadhesin, CUB domain 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_017505222.1.32401
Sequence length 843
Comment PREDICTED: deleted in malignant brain tumors 1 protein isoform X1 [Manis javanica]; AA=GCF_001685135.1; RF=representative genome; TAX=9974; STAX=9974; NAME=Manis javanica; AL=Scaffold; RT=Major
Sequence
MTPVYDWWTTRTPVTGSESGLALRLVNGSDHCQGRVEVLYRGSWGTVCDDSWDTNDANVV
CRQLGCGWAKSAPGSARFGQGSGPIVLDDLRCSGHESYLWSCPHNGWNSHNCGHSEDAGV
ICSGVHTTASTPGWWHSSSVTTEGPSSNCGGIFFNTSGTFSSPSYPEYYPNNAKCVWEIV
VNSSYRVNLGFSNVQLEINNNCSLDYVEIFDGSLNSYNLLGKICNATTQIFTSSYNRMIV
RFRSDVSFQNTGFSAWYNSFPRDASLRLVNSNVSHTCSGRVEIYHGGKWGTVCDDSWSIQ
DAHVVCRQLECGYAVSALGNAYFGPGSGPITLDDVQCSGMESNLWQCQSRGWFSHNCAHS
EDAGVICSGRSHLTTFAPGQNGTRPATNYSCGGFLSQPSGVFSSPFYPGNYPSNAKCVWD
IEVQNNYRVTVVFRDVELESGCNYDYVEVFDGPHQSSPLITRVCDGARGSLTSSSNFMSI
RFVSDGSITRRGFKANYYSSPSNESTNLLCLPNHMQASVSRSYLQSLGYSVWDLVILNWN
GSSLCQSRITSSRVTFTIPYTGCGTIKQVDNDTIIYSNLLKAAPSDGIIRREQGLRIHVS
CRMLQDTWVDTMYIANDSIEVNKVQYGNFDVNISFYTSSSFAHPVTSRPYYVDANQNVYL
QAKIIHPDTFLALFVDTCVASPYSNDFTSLTYDIIRSGCVKDKTYQSYYQPLPHIARFKF
STFYFLNRFPSVYLKCKMVVCRLNDYSSRCSRGCVRRSKRDVGSYEEKVDVVLGPIQLQA
PHVEKRSLDLPAASVEEQASAQGSYHSAAISAGVFLVVVLAVAAFTLGRSTRATSGQPLS
QKV
Download sequence
Identical sequences XP_017505222.1.32401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]