SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_017588898.1.15636 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017588898.1.15636
Domain Number 1 Region: 386-535
Classification Level Classification E-value
Superfamily TRAF domain-like 2.62e-51
Family MATH domain 0.0000000838
Further Details:      
 
Domain Number 2 Region: 347-385
Classification Level Classification E-value
Superfamily Trimerization domain of TRAF 0.000000000000011
Family Trimerization domain of TRAF 0.00058
Further Details:      
 
Domain Number 3 Region: 96-139
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000193
Family RING finger domain, C3HC4 0.021
Further Details:      
 
Domain Number 4 Region: 202-254
Classification Level Classification E-value
Superfamily TRAF domain-like 0.000000248
Family SIAH, seven in absentia homolog 0.017
Further Details:      
 
Domain Number 5 Region: 168-217
Classification Level Classification E-value
Superfamily TRAF domain-like 0.00000412
Family SIAH, seven in absentia homolog 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_017588898.1.15636
Sequence length 537
Comment PREDICTED: TNF receptor-associated factor 2 isoform X1 [Corvus brachyrhynchos]; AA=GCF_000691975.1; RF=representative genome; TAX=85066; STAX=85066; NAME=Corvus brachyrhynchos; AL=Scaffold; RT=Major
Sequence
MRAAPRVSPTRHFSCHRRPAVSVLPPPILPDRWPPPVPRTGATGREEAMALCAQSLEIQP
ELFVHMAAANSSPPGSLDLNQPGFAKEILGTKLEVKYLCSDCKNILRRPFQAQCGHRYCS
YCLKKIISAGPQKCASCIQEGIYEEGISILETSSAFPDNAARREVESLPAVCINSGCTWK
GTIKEYEAHDEVCPEFPLTCEGCGKKIPREKFRDHVKTCGRSKVPCRFEAVGCAEVVENE
KLLEHESKCLAEHLHMLLSSLLSLKAGAGDPKSLPVLSSSQNSSPLLAANSLCSESELSR
SLELLGRCEALERKTVTFENIVCVLNREVERVSLTAEAYSRQHRLDQEKIETLSNKVRQL
ERSIGLKDLAMAEMEEKIRNMEASTYDGVFIWKITEFARKRQEAITGRSPAIFSPAFYTS
KYGYKMCLRLYLNGDGTGRGTHLSLFFVVMKGPNDALLRWPFNQKVTLMLLDQNNREHII
DAFRPDVTSSSFQRPVTEMNIASGCPLFCPVSVMEAKNSYVRDDAIFIKAIVDLTGL
Download sequence
Identical sequences XP_017588898.1.15636

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]