SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_018163909.1.57863 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_018163909.1.57863
Domain Number 1 Region: 72-163
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 7.2e-20
Family Cold shock DNA-binding domain-like 0.00016
Further Details:      
 
Domain Number 2 Region: 2-71
Classification Level Classification E-value
Superfamily N-terminal, heterodimerisation domain of RBP7 (RpoE) 1.23e-17
Family N-terminal, heterodimerisation domain of RBP7 (RpoE) 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_018163909.1.57863
Sequence length 165
Comment RNA polymerase ii subunit 7 [Colletotrichum higginsianum IMI 349063]; AA=GCF_001672515.1; RF=representative genome; TAX=759273; STAX=80884; NAME=Colletotrichum higginsianum IMI 349063; strain=IMI 349063; AL=Chromosome; RT=Major
Sequence
MERRVTLHPSYFGRNMHELVTSKLLKDVEGTCAGSYYIISIMDTFDISEGRILPGSGLAE
FTVGYRAVVWRPFKGETVDAVVYSVNHQGFFAQAGPLRLFVSAHLIPSEIKWDPNATPPQ
FTNNEDTIIEPGTHVRVKVIGTRTEVGEMWAIGSIKEDYLGCLQD
Download sequence
Identical sequences A0A1B7YTW1
XP_018163909.1.57863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]