SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_018170122.1.98922 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_018170122.1.98922
Domain Number 1 Region: 33-137
Classification Level Classification E-value
Superfamily FAD-dependent thiol oxidase 2.22e-41
Family FAD-dependent thiol oxidase 0.0000211
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_018170122.1.98922
Sequence length 138
Comment hypothetical protein QG37_02425 [[Candida] auris]; AA=GCF_001189475.1; RF=representative genome; TAX=498019; STAX=498019; NAME=[Candida] auris; strain=6684; AL=Scaffold; RT=Major
Sequence
MATGGMNKAPQKAKTEVAAPAASKETDVYAKVDPPDVEKLGRSSWTLLHSIAATYPENPS
NKQQADMKQFLKLFGNFYPCWFCAEDFEKYMAKNEPTTDTQDHLGKWLCEAHNDVNKKLG
KPEFDCNLWKKRWKDGWE
Download sequence
Identical sequences A0A0L0P296
XP_018170122.1.98922

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]