SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_018328574.1.13287 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_018328574.1.13287
Domain Number 1 Region: 1-78
Classification Level Classification E-value
Superfamily N-terminal, heterodimerisation domain of RBP7 (RpoE) 4.05e-21
Family N-terminal, heterodimerisation domain of RBP7 (RpoE) 0.0018
Further Details:      
 
Domain Number 2 Region: 79-193
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000000000583
Family Cold shock DNA-binding domain-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_018328574.1.13287
Sequence length 200
Comment PREDICTED: DNA-directed RNA polymerase III subunit RPC8 [Agrilus planipennis]; AA=GCF_000699045.1; RF=representative genome; TAX=224129; STAX=224129; NAME=Agrilus planipennis; AL=Scaffold; RT=Major
Sequence
MFILTEMKNVIRIPPEYFHIKLNYAIADELNKKLANKVMLNVGLCIALFDITNIKESYIL
PGDEASHTGVTFRYIVFRPFIEEILLGKIRSCSQEGVHISLGFFDDILIPPTALQHPSRF
DETEQAWVWQYDMGDGNKHDLFMDAGESIRFKVTAEVFQETCPSGPALSETRDSIEAKVP
YLIKGSINEPGLGLLSWWNN
Download sequence
Identical sequences A0A1W4WXJ1
XP_018328574.1.13287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]