SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_018342515.1.14990 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_018342515.1.14990
Domain Number 1 Region: 1-78
Classification Level Classification E-value
Superfamily N-terminal, heterodimerisation domain of RBP7 (RpoE) 2.09e-23
Family N-terminal, heterodimerisation domain of RBP7 (RpoE) 0.00000836
Further Details:      
 
Domain Number 2 Region: 78-169
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.94e-20
Family Cold shock DNA-binding domain-like 0.0000169
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_018342515.1.14990
Sequence length 181
Comment PREDICTED: DNA-directed RNA polymerase II subunit RPB7 isoform X1 [Trachymyrmex septentrionalis]; AA=GCF_001594115.1; RF=representative genome; TAX=34720; STAX=34720; NAME=Trachymyrmex septentrionalis; AL=Scaffold; RT=Major
Sequence
MFYHISLEHEILLHPRYFGPQLLDTVKQKLYTEVEGTCTGKYGFVVAVTTIDNIGAGIIQ
PGQGFVVYPVKYKAIVFRPFKGEVLDAIVTQVNKVGMFAEIGPLSCFISHHSIPEDMQFC
PNVNPACYKSKEEDVVIQADDEIRLKIVGTRVDATGIFAIGTLMDDYLGNRILNVIVLQG
I
Download sequence
Identical sequences XP_018342515.1.14990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]