SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_018362597.1.32933 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_018362597.1.32933
Domain Number 1 Region: 96-548
Classification Level Classification E-value
Superfamily Sema domain 3.53e-123
Family Sema domain 0.0000568
Further Details:      
 
Domain Number 2 Region: 1435-1559,1814-1998
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.71e-42
Family p120GAP domain-like 0.03
Further Details:      
 
Domain Number 3 Region: 899-989
Classification Level Classification E-value
Superfamily E set domains 0.000000000000021
Family Other IPT/TIG domains 0.022
Further Details:      
 
Domain Number 4 Region: 1078-1149
Classification Level Classification E-value
Superfamily E set domains 0.000000000000672
Family E-set domains of sugar-utilizing enzymes 0.08
Further Details:      
 
Domain Number 5 Region: 550-602
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000327
Family Plexin repeat 0.0023
Further Details:      
 
Domain Number 6 Region: 991-1078
Classification Level Classification E-value
Superfamily E set domains 0.000000000896
Family Other IPT/TIG domains 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_018362597.1.32933
Sequence length 2034
Comment PREDICTED: plexin-B [Trachymyrmex cornetzi]; AA=GCF_001594075.1; RF=representative genome; TAX=471704; STAX=471704; NAME=Trachymyrmex cornetzi; AL=Scaffold; RT=Major
Sequence
MRFLGFTQSFPKSPTVTHLQVPLPPLLHRLSFSSMSIATWFLVILATAAIDTPASTVPSI
QDNKSPHIIAQFPVGNGQRYGHFSLDANATREGALRFNHLAIDPSSGRLYGAAINRLFQL
DSNLRLEEYVSTGPRLDNPQCHATGCMARDIPTSLMDNVNKLLIADVKSQMLIACGSLLQ
GACEKYQMSNISIKPEFIPHSVAANDENSSTYAFIGPQKYNTWEQPNILYVGTTFTNKGD
YRHDVPAISSRKLDNLEFAEYTFNKQSIVYIDVKYRDHFLVKYVYGFNASDYAYFVLVQK
QSYLPEQEELGYISRLARSCISDANYDSYTEVTLQCTVDLGDGKQHYYNLVQDAKVAAAG
SDLAMQLGISVGDPVFVSVFSPSRGITNEPLSRSAVCIYSLQDIETKFNENIHMCFNGSI
KYRNMGYVSGPIQDGKCPTAGTTGNILNFCEVGLKISGVSPITGQAILHFPDTFISSVTI
ANTESHTVAFFGTNDGILKKVLLSGVEAFVYESVTIDKGQKLLPDTLISPDGEYIYVLSN
SKISKVKVEHCNGYTNCSSCLDAKDPYCGWCSLEKRCTVRGDCQKASHSSPRWLSLGTGQ
QCIDFEQVLPDRMPINQMTTVQLTIRTLPELPTGANYKCVFGNAEPIDALMTGFGLSCPT
PPVVERPSIPEGADHVLVPLSVRSSETNKDFVSRNFAFFDCSRHTVCTECVKSQWACSWC
VYDNKCTHNTSCQGIISGENQKQANLAAHGAQYCPRFMERKEPLMLPNSVPKEIVLEVEN
LPHPQVGHSGFQCIVSIEGANLKVQARVDSSRFIVCDKTVYSYEEISGEYEAEVTVVWNT
NHHVDKTTIILYKCEVLGSHREHADCSLCVTRDTRFECTWCGNSCVYRHSCLQSPFTECP
KPRIDMIKPLSGPIEGGTLVTIEGSNLGLKESDVEGKIHIGNTPCTLVDYEVSVRIVCRT
GRHEATDAASVVVGNDAGYTESAVLFNYKDIRLSGVYPSVGPQSGGTQLAITGKYLNIGS
TISAYLDELPCHVNATQASSTRLTCVTSKSGRVRRIHRLTLSIDGANRTLMDNPYNYTHD
PTIMEIKPLRSFASGGRMITVHGTNLDTIQKPEMEVYFDNEQLPVNRTVCTVLNPTQMEC
PSPSVAKRFVSIRRSERSAATSTLGTSSPHSLRLKESQLSLKIAFIMDNVESVKDLEKQS
LRNRLLYVEDPTFFPFPRNVKLYKGDTLVIEGENLNYASDESDVNVTVGIMPCNVTSLAL
TQLVCTPPDQQPADTDELGIKTESGLPLVVVRVGRSLRFPIGYLRYEVIKSYPIPPEAIA
GIAAGTFGLIFLFVLVLVIYRRKSTQAEREYKRIQIQMDTLESNVRMECKQAFAELQTDM
TDLTADLESSGIPTLDHKNYIMKVFFPGVIDHPILNDPRSRSNISRTNYDAAMIQFEQLV
NNKYFVLTFIETLEAQKDFNIRDKVNVASLLMVVLMGKMEYATDILMNLLLRLIDKAVNT
KHPQLMLRRTESVVEKMLTNWMALCMYNYLKDYAGSSLFLLFKAIKHQIEKGPVDVITHD
ARYSLSEERLLREQIEHTIVTLHVVQDDLDEKIQCKVLDCDTISQVKSKILDALYKNTPF
SLRPSVHDVDLEWRHGRGGHLTLQDEDLTTKCCGEWKKINTLAHYGVKESAVMSLIPRQN
DGFSVACKPPCHNCKPSHYHPQQQPSIHPHHQPSHHHLHRHSNHCSSTHLPSTPNHGLIT
PVMYNHPVSGLYFDSQHSPPIITANGDVESAHGGNQRLYHLVRPIEDVHYPPGLGFTGSS
KHHHPERTHKAIPEIFLTRLLSTKGTVQKFVDDFLNTILTANEALPSAVKWLFDLLDEAA
KQHGIVDPEVAHAWKSNSLPLRFWVNFIKNPDFMFDINKSTTVDSSLSVIAQTFMDSCSM
TEHRLGKDSPSNKLLFAKDIPHYREKVGRFYTDVQRLPQITDQEMSSAMQQLSASHANEF
DVIAALKELYIYVSKYYEQILEALETDAGCRKLHLAHRLENVAYTLEGEETSAC
Download sequence
Identical sequences XP_018362597.1.32933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]