SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_018440964.1.40639 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_018440964.1.40639
Domain Number 1 Region: 1-82
Classification Level Classification E-value
Superfamily N-terminal, heterodimerisation domain of RBP7 (RpoE) 0.000000000000432
Family N-terminal, heterodimerisation domain of RBP7 (RpoE) 0.0026
Further Details:      
 
Domain Number 2 Region: 84-158
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000000351
Family Cold shock DNA-binding domain-like 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_018440964.1.40639
Sequence length 175
Comment PREDICTED: DNA-directed RNA polymerase IV subunit 7-like [Raphanus sativus]; AA=GCF_000801105.1; RF=representative genome; TAX=3726; STAX=3726; NAME=Raphanus sativus; cultivar=WK10039; AL=Scaffold; RT=Major
Sequence
MFIKVKLPWNVIIPAEAMDPNGHMIQTAVLTRLLDAFASKKATKDLGYFIALKSLEEIGE
GRIRETTGEIVFPVVFSGITFKMFKGEIVRGVVHKVHKSGVFLRCGPCENVYLSHYKMPG
YDYVVQGNPLFVNENMSRIQIGSTVRFVVLDIQWKEAEKEFIALASLEGINLGPF
Download sequence
Identical sequences XP_018440961.1.40639 XP_018440962.1.40639 XP_018440963.1.40639 XP_018440964.1.40639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]