SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_018563335.1.56492 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_018563335.1.56492
Domain Number 1 Region: 186-302
Classification Level Classification E-value
Superfamily eIF-2-alpha, C-terminal domain 8.11e-40
Family eIF-2-alpha, C-terminal domain 0.0000068
Further Details:      
 
Domain Number 2 Region: 89-182
Classification Level Classification E-value
Superfamily eIF2alpha middle domain-like 4.05e-34
Family eIF2alpha middle domain-like 0.0000489
Further Details:      
 
Domain Number 3 Region: 10-91
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.64e-18
Family Cold shock DNA-binding domain-like 0.0000354
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_018563335.1.56492
Sequence length 327
Comment PREDICTED: eukaryotic translation initiation factor 2 subunit 1 [Anoplophora glabripennis]; AA=GCF_000390285.1; RF=representative genome; TAX=217634; STAX=217634; NAME=Anoplophora glabripennis; AL=Scaffold; RT=Major
Sequence
MPLSCRFYKEKYPEVEDVVMVNVRAIAEMGAYVHLLEYNNIEGMILLSELSRRRIRSINK
LIRVGKTEPVVVIRVDKEKGYIDLSKRRVSAEDVEKCTERFAKAKAVNSILRHVAELLRY
ESDEQLEELYQKTAWYFEEKYKKNKASAYDFFKQAVLDPSILAECDLDEKTKEVLLGNIK
RKLTSQAVKIRADIECACYGYEGIDAVKTALKAGLSLSTEELPIKINLIAPPLYVMTTST
PEKQDGLKILNDAIEKIKITINGLGGVFNVQMAPKVVTATDEAELVKQMERAELENAEVA
GDDDEEEQDEGQVYSEGEDKGESENED
Download sequence
Identical sequences XP_018563335.1.56492

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]