SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_018900794.1.81087 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_018900794.1.81087
Domain Number 1 Region: 134-274
Classification Level Classification E-value
Superfamily ISP domain 7.86e-39
Family Rieske iron-sulfur protein (ISP) 0.0000031
Further Details:      
 
Domain Number 2 Region: 80-148
Classification Level Classification E-value
Superfamily ISP transmembrane anchor 5.01e-17
Family ISP transmembrane anchor 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_018900794.1.81087
Sequence length 275
Comment PREDICTED: cytochrome b-c1 complex subunit Rieske, mitochondrial [Bemisia tabaci]; AA=GCF_001854935.1; RF=representative genome; TAX=7038; STAX=7038; NAME=Bemisia tabaci; AL=Scaffold; RT=Major
Sequence
MIKAISRGGQFGAFSKATAQAIPPPSASVLVPATLPPSSKPLVEIDRSLLTSDSLGKAVS
SINNFGVISGPGVTTQVRFAHTDVKVPDFTAYRRDSTKSPTSDNDKSLGSRAAFSYLFTA
GSLAGAIYGGKGIVHAFVTSMSASADVLAVSTIEVKLSAIPEGQCVTFKWRGKPLFIRHR
TQEEISRERAVPLSDLRDPQEDEVRVQKPEWLVVLGVCTHLGCVPIANAGDFGGYYCPCH
GSHYDASGRIRKGPAPLNLEVPKYAFTDPDTVLVG
Download sequence
Identical sequences XP_018900794.1.81087

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]