SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_019003619.1.25069 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_019003619.1.25069
Domain Number 1 Region: 147-281
Classification Level Classification E-value
Superfamily ISP domain 6.42e-40
Family Rieske iron-sulfur protein (ISP) 0.00000258
Further Details:      
 
Domain Number 2 Region: 105-159
Classification Level Classification E-value
Superfamily ISP transmembrane anchor 0.0000000000000327
Family ISP transmembrane anchor 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_019003619.1.25069
Sequence length 287
Comment ubiquinol-cytochrome c reductase, iron-sulfur subunit [Kwoniella mangroviensis CBS 8507]; AA=GCF_000507465.1; RF=representative genome; TAX=1296122; STAX=463800; NAME=Kwoniella mangroviensis CBS 8507; strain=CBS 8507; AL=Scaffold; RT=Major
Sequence
MASVTRLNLLPTSRTLASGIPLAPKINLAVPVGISGAHGHGHGAAGARSDVPQAWAFKSG
FRGHVGKTNALPTSSSFQQRHFSSTPTPSAAHPMAGATGIPRASATGVPDFSPYKAKNAS
LNRTFSYFMVGGLGVLGASGIKSTVSDILSNMAASADVLALAKIEVEMGAIPEGKNLIVK
WRGKPVFIRHRTPDEIDEANQVDVKSLRDPEKDDDRVQRPEWLVMLGVCTHLGCVPIGEA
GDYGGWFCPCHGSHYDISGRIRRGPAPLNLEVPEYSFNDDEEKIVIG
Download sequence
Identical sequences A0A1B9J288
XP_019003619.1.25069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]