SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_019038419.1.93583 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_019038419.1.93583
Domain Number 1 Region: 244-406
Classification Level Classification E-value
Superfamily eEF1-gamma domain 7.85e-64
Family eEF1-gamma domain 0.0000129
Further Details:      
 
Domain Number 2 Region: 72-200
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 5.99e-31
Family Glutathione S-transferase (GST), C-terminal domain 0.000043
Further Details:      
 
Domain Number 3 Region: 1-69
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000137
Family Glutathione S-transferase (GST), N-terminal domain 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_019038419.1.93583
Sequence length 406
Comment hypothetical protein WICANDRAFT_31960 [Wickerhamomyces anomalus NRRL Y-366-8]; AA=GCF_001661255.1; RF=representative genome; TAX=683960; STAX=4927; NAME=Wickerhamomyces anomalus NRRL Y-366-8; strain=NRRL Y-366-8; AL=Scaffold; RT=Major
Sequence
MSQGTLYVGESSRGLLLKGLIKHYKLDINVTDRDATYQKLFPLGKVPAFVGPKGYKLTEV
IAIVLYVISLGDEKSPLLGKNNREYAQIIRWLSLANSEWLPAIGSAFGPLIGRVPYNKKQ
VTDSSAAADKVASVFEARLAEFTYLVGERITLADLFAASLATRGFNYLWGKEWRAKYPNV
VRWFTTVTAHPILADQYKNFEFRDAPVEFTPPKKEKKEQAPKAAAPKAAPKPAAEAPAEP
APKPKHPLELLGKSTNFNLDEWKRFYSNEETRETALPWFWEHYDPSEWSLWRVDYKYNDE
LTLTFMSNNLLGGFFNRLSASTKYLFGSGVVYGENNNNGIVGVFLVRGQEHEPAFNVAPD
WESYSFAKLDPSKPEDKTFVDDVFAWDKPLTINGETREVADGKVFK
Download sequence
Identical sequences A0A1E3P2U7
jgi|Wican1|31960|e_gw1.4.275.1 XP_019038419.1.93583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]