SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_019530161.1.17567 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_019530161.1.17567
Domain Number 1 Region: 1-78
Classification Level Classification E-value
Superfamily N-terminal, heterodimerisation domain of RBP7 (RpoE) 7.19e-24
Family N-terminal, heterodimerisation domain of RBP7 (RpoE) 0.0000112
Further Details:      
 
Domain Number 2 Region: 78-169
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.2e-19
Family Cold shock DNA-binding domain-like 0.0000169
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_019530161.1.17567
Sequence length 173
Comment PREDICTED: DNA-directed RNA polymerase II subunit RPB7-like [Aedes albopictus]; AA=GCF_001876365.2; RF=representative genome; TAX=7160; STAX=7160; NAME=Aedes albopictus; AL=Contig; RT=Major
Sequence
MFYHISLEHEILLHPRYFGPQLIETVKQKLYTEVEGTCTGKYGFVIAVTTIDDIGSGLIL
PGQGFVVYPVKYKAIVFRPFKGEVLDAVVTQVNKVGMFAQIGPLSCFISHHSIPADMQFC
PNGNPPCYKSKDEDVVIALEDKIRLKIVGTRVDATGIFAIGTLMDDYLGLAGS
Download sequence
Identical sequences A0A023EIT6
XP_019530161.1.17567 XP_019543008.1.17567

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]