SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_019778716.1.83887 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_019778716.1.83887
Domain Number 1 Region: 237-477
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 5.34e-55
Family Decarboxylase 0.000000533
Further Details:      
 
Domain Number 2 Region: 11-205
Classification Level Classification E-value
Superfamily PRTase-like 1.56e-44
Family Phosphoribosyltransferases (PRTases) 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_019778716.1.83887
Sequence length 480
Comment PREDICTED: uridine 5'-monophosphate synthase [Tursiops truncatus]; AA=GCF_001922835.1; RF=na; TAX=9739; STAX=9739; NAME=Tursiops truncatus; AL=Scaffold; RT=Major
Sequence
MAADDAALESLVTGLYDVQAFKFGNFVLKSGLSSPVYIDLRGIVSRPRILSQVAEILFQT
AQNAGINFDTVCGVPYTALPLATVICSTNQIPMLIRRKETKDYGTKRLVEGAINPGETCL
IIEDVVTSGSSVLETVEALQKEGLKVTDAIVLLDREQGGKDKLQAHGIRLHSVCTLSKML
EILEQQKKIDAEMVERVKRFIQENVFVTANRNGSFPSVKKGPKELSFGARAELPGIHPVA
SKLLRLMQKKETNLCLSADISESRELLQLADALGPRICMLKTHVDILNDFTLDVMKELTI
LAKRHEFLIFEDRKFADIGNTVKKQYEGGVFKIASWADLVNAHVVPGSGVVKGLGEVGLP
LHRACLLIAEMSSAGSLATGSYTEAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQ
LEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGITTSANRLDAAEMYRKAAWEAYLSRLAL
Download sequence
Identical sequences ENSTTRP00000014165 XP_019778716.1.83887 ENSTTRP00000014165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]