SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_019924886.1.10878 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_019924886.1.10878
Domain Number 1 Region: 109-227
Classification Level Classification E-value
Superfamily Phospholipase A2, PLA2 2.68e-27
Family Insect phospholipase A2 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_019924886.1.10878
Sequence length 240
Comment PREDICTED: phospholipase A2-like isoform X1 [Crassostrea gigas]; AA=GCF_000297895.1; RF=representative genome; TAX=29159; STAX=29159; NAME=Crassostrea gigas; strain=05x7-T-G4-1.051#20; AL=Scaffold; RT=Major
Sequence
MKLLMIIFVFVFVCQVCGKKVHKKQDPPYKGNVTLFLRSHDMVYTFKVRGRTIKLQRPIL
NLREKYENERKKSKKGRSLRSIMSDEELNELRKLIQAPHAISRRDLDLIYPGTKWCGAGN
DAATYDDLGTAEEVDMCCREHDHCDMFIEAGQSKYGLTNDGDYTRVSCDCDKTFYDCLSN
AQEDSFDAAMIGFIYFDVLDQDCIRKKRICTGYSWWGTCKSWTEVDDEYEFGSNELDYIW
Download sequence
Identical sequences XP_011434510.2.10878 XP_019924886.1.10878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]