SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_019965304.1.63745 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_019965304.1.63745
Domain Number 1 Region: 5-116
Classification Level Classification E-value
Superfamily SRP19 1.26e-37
Family SRP19 0.00000432
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_019965304.1.63745
Sequence length 141
Comment PREDICTED: signal recognition particle 19 kDa protein [Paralichthys olivaceus]; AA=GCF_001970005.1; RF=representative genome; TAX=8255; STAX=8255; NAME=Paralichthys olivaceus; breed=gynogenesis; AL=Scaffold; RT=Major
Sequence
MAHLTQNPADKLRFVCLYPVYINNKKTLAEGRRIPTEKAVENPSCAEIRDVLTAAGMNVY
VENKMHPREWNRDVQFRGRVRVQLKQEDGRLCQDKFSSRKDVMFYVAEMIPKLKTRTQKS
GGGESSSQQGEGGKKSKKKKK
Download sequence
Identical sequences XP_019965304.1.63745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]