SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_020016073.1.5219 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_020016073.1.5219
Domain Number 1 Region: 265-320
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.85e-23
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 2 Region: 600-657
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.15e-23
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 3 Region: 377-434
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6e-22
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 4 Region: 546-601
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.59e-22
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 
Domain Number 5 Region: 211-266
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.4e-22
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 6 Region: 433-490
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.52e-20
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 7 Region: 5-58
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.14e-20
Family KRAB domain (Kruppel-associated box) 0.00065
Further Details:      
 
Domain Number 8 Region: 324-378
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.85e-20
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 9 Region: 646-698
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.78e-19
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 10 Region: 489-543
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.99e-18
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 11 Region: 153-208
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000878
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 12 Region: 87-139
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000042
Family Classic zinc finger, C2H2 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_020016073.1.5219
Sequence length 717
Comment zinc finger protein 709-like isoform X1 [Castor canadensis]; AA=GCF_001984765.1; RF=representative genome; TAX=51338; STAX=51338; NAME=Castor canadensis; AL=Scaffold; RT=Major
Sequence
MKTSVESVTFEDLAVNFTHEEWALLGPSQKDLYRDVMLETFSHLASIGNKWEGQNIKDKH
KNPGENLRYIIPHSGYKPYEHEEYGEKQYKCKQSGKTVISLTSVQGHMASHNVNGPYECK
VCLKTFDFLSLFQIHQHTHSAKNPHERKQSGKAFVCSTSFQIRRSTHTVEKFYGCKQCGK
VFRHLRYLRVHEKTHSEENPYVCKQCGKSLSCSSALKLHERTHSGEKPYECKQCGKAFRR
RSYLRVHQTTHSEERPYECKQCGKVFKTHSSLQVHERIHTGEKPYECKQCGKAFTHLGYL
RVHERTHTGEKPYACKQCGKTLSSSSYLRVHERIHTGEKPHECKQCGKAFRHLSHLRAHE
RTHSGEKTYECKQCCKAFIHLWSLRVHERTHSEEKPYECQQCGRTFSCSRSLKLHERTHT
GEKPYACKVCGKVFIAHSSLRIHERIHSGDKMYECKQCGKTLSCSSSLKLHERTHTGGKP
FGCKQCGKAFRHLSYLRVHESTHTGENYECKQCGKAFRHLSYLRIHERTHSAEKPYECKQ
CGKTLSCSSYLRVHERTHTGEKPYECKQCDKAFSHHNSLLLHERTHTGEKPYECMQCGKV
FIDHSSLRRHERIHTGEKPYECKQCGKTLSCSSSLKLHERTHTGEKPYECKRCGKAFRYF
SYVQVHERTHTGEKPYECKQCGKSFRHLSSLQVHERTHTGGKNLTNVNNVKKPSGIC
Download sequence
Identical sequences XP_020016072.1.5219 XP_020016073.1.5219 XP_020016075.1.5219 XP_020016076.1.5219

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]