SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_020077546.1.17418 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_020077546.1.17418
Domain Number 1 Region: 112-216
Classification Level Classification E-value
Superfamily FAD-dependent thiol oxidase 1.16e-36
Family FAD-dependent thiol oxidase 0.0000119
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_020077546.1.17418
Sequence length 249
Comment hypothetical protein HYPBUDRAFT_151931 [Hyphopichia burtonii NRRL Y-1933]; AA=GCF_001661395.1; RF=representative genome; TAX=984485; STAX=717740; NAME=Hyphopichia burtonii NRRL Y-1933; strain=NRRL Y-1933; AL=Scaffold; RT=Major
Sequence
MVTTFLLLVVISIIYYMSSSSSTSSLGNISPITRNSIQNENLNLVNQQQKSEKIIEQEET
AEDPEVIKRPTKQKEEPAKEQVPVKEAQPLEDEGAAIQITETPFMPKMANETLKAQLGNA
AWKLFHTILARYPDKPSQQEQSTLNTYIQLFGQVYPCGDCARHFQHLLKKFPPQVGSRKT
AALWGCDIHNKVNEKLHKSQYDCTTILEDYDCGCGGDEQEKDFTLGNESIDHVRNIKVDE
KEDKLQLGG
Download sequence
Identical sequences A0A1E4RMJ9
XP_020077546.1.17418 jgi|Hypbu1|151931|fgenesh1_kg.2_#_97_#_Locus152v1rpkm1362.08

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]