SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_020291110.1.29359 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_020291110.1.29359
Domain Number 1 Region: 129-254
Classification Level Classification E-value
Superfamily ISP domain 7.73e-36
Family Rieske iron-sulfur protein (ISP) 0.0000078
Further Details:      
 
Domain Number 2 Region: 60-127
Classification Level Classification E-value
Superfamily ISP transmembrane anchor 0.0000000000000632
Family ISP transmembrane anchor 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_020291110.1.29359
Sequence length 256
Comment cytochrome b-c1 complex subunit Rieske, mitochondrial-like [Pseudomyrmex gracilis]; AA=GCF_002006095.1; RF=representative genome; TAX=219809; STAX=219809; NAME=Pseudomyrmex gracilis; AL=Scaffold; RT=Major
Sequence
MLTFRRVIKILMCYLYFYLVIKMYVIKGRILNIFVENCNIYSSLLGPHSINHLKKLYRYA
HIDIPKPNFEEYRRKSLQDSETSARESANQRKTLSCVASFAGGVAGLYALKSHMLHYIYF
LSPSRDIIAVAQLEVNLSTIPVGKVSIVKWRGKPVFIYHRSQSIIEQERAVSLSELRDPQ
TDDDRVKKPEWLVVIGICTHLGCVPIPNAGIITGGFFCPCHGSHFDASGRIRKGPAPTNM
EIPEYKFINDCNVIIG
Download sequence
Identical sequences XP_020291110.1.29359

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]