SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_020740580.1.74333 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_020740580.1.74333
Domain Number 1 Region: 1-104
Classification Level Classification E-value
Superfamily TRADD, N-terminal domain 1.44e-42
Family TRADD, N-terminal domain 0.0000043
Further Details:      
 
Domain Number 2 Region: 206-294
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000000000132
Family DEATH domain, DD 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_020740580.1.74333
Sequence length 297
Comment tumor necrosis factor receptor type 1-associated DEATH domain protein isoform X5 [Odocoileus virginianus texanus]; AA=GCF_002102435.1; RF=representative genome; TAX=9880; STAX=9874; NAME=Odocoileus virginianus texanus; AL=Scaffold; RT=Major
Sequence
MLKIHRSDPQLIVQLRFSGRQTCGRFLRAYREGALRATLQGCLARALALNAVPLQLELRA
GAEQLDAVLTDEERCLNCICAQKPDRLRDEELTELEDALRNLTCGSAAGQGGDVQGTPAP
SQSLAPSPPEEKPPPPPPGQTFFFQGQVIGETPRERERQDPQEDEAWGGARSGRGSHGGN
GRVSQAHSLPTLSAVNRPLNLQDQQKFARSVGLKWRKVGRSLQRSCRALRDPALDSLAYE
YEREGLYEQAFQLLRRFVQAEGRRATLQRLVEALEENELTSLAEDLLGLANPDGGLA
Download sequence
Identical sequences XP_020740580.1.74333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]