SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_020760109.1.74333 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_020760109.1.74333
Domain Number 1 Region: 12-117
Classification Level Classification E-value
Superfamily Nucleoplasmin-like core domain 8.11e-43
Family Nucleoplasmin-like core domain 0.00000633
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_020760109.1.74333
Sequence length 260
Comment nucleophosmin-like isoform X2 [Odocoileus virginianus texanus]; AA=GCF_002102435.1; RF=representative genome; TAX=9880; STAX=9874; NAME=Odocoileus virginianus texanus; AL=Scaffold; RT=Major
Sequence
MEDSMDMDMSPLRPQNYLFSCELQADRDDHFKADNDENEHQLSLRTVSLGAGAKDELHIV
EAEAMNYEGSPIKVTLATLKMSVQPVVSLGGFEITPPVVFRLKCGSGPVHISGQHLVAVE
EDAESEDEEEEDVKLLSISGKCSAPRSGSKFPQKKVKLAADEDDDDDDADNDDDDDFDEE
AEEKAPVKKGQESFKKQEKTPKTLKGPSSVEDIKAKMQARIEKSGSLPKVEAKFINYVKN
CFLMTDQEAIQDLWQWRKFL
Download sequence
Identical sequences XP_020760109.1.74333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]