SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_020921305.1.46622 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_020921305.1.46622
Domain Number 1 Region: 1-103
Classification Level Classification E-value
Superfamily Retroviral matrix proteins 1.65e-42
Family MMLV matrix protein-like 0.00000876
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_020921305.1.46622
Sequence length 240
Comment uncharacterized protein LOC110255823 [Sus scrofa]; AA=GCF_000003025.6; RF=representative genome; TAX=9823; STAX=9823; NAME=Sus scrofa; breed=Duroc; AL=Chromosome; RT=Major
Sequence
MGQTVTTPLSLTLNHWTEVKSRAHNLSVQVKKGPWQTFCVSEWPTFDVGWPSEGTFNSEI
ILAVKAIIFQTGPGSHPNQEPYILTWQDLAEDPPPWVKPWLNKPRKPGPRILALGEKNKH
SAEKVKPSPHIYPEIEEPPAWPEPQSVPPPLYPAQGAARGPSDPPGAPAVEGPAAGTRAG
GAPPRSGQTRSRHYRCACTALPYRGANCSPSSIGPFLLQISIIGKLTIPLSRRIPNASRR
Download sequence
Identical sequences XP_020921305.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]