SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_020943758.1.46622 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_020943758.1.46622
Domain Number 1 Region: 35-125
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.14e-37
Family SCAN domain 0.0000424
Further Details:      
 
Domain Number 2 Region: 443-500
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.15e-25
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 3 Region: 584-641
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.37e-24
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 4 Region: 485-537
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.23e-21
Family Classic zinc finger, C2H2 0.003
Further Details:      
 
Domain Number 5 Region: 630-682
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.35e-18
Family Classic zinc finger, C2H2 0.0024
Further Details:      
 
Domain Number 6 Region: 212-267
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000000000183
Family KRAB domain (Kruppel-associated box) 0.0045
Further Details:      
 
Domain Number 7 Region: 375-417
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000649
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 8 Region: 527-585
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000258
Family Classic zinc finger, C2H2 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_020943758.1.46622
Sequence length 684
Comment zinc finger protein 263 isoform X1 [Sus scrofa]; AA=GCF_000003025.6; RF=representative genome; TAX=9823; STAX=9823; NAME=Sus scrofa; breed=Duroc; AL=Chromosome; RT=Major
Sequence
MALGPAFQDREGLLIVKLEEDCAWSQELPPPDPRPSPEASHLRFRRFRFQEASGPREALS
RLQELCHGWLRPEMRTKEQILELLVLEQFLTILPQEIQSRVQELHPESGEEAVTLVEDMQ
KELGRLRKKVTNHGRGTEVLLEEPLPLETAAESPSFKLEPMETERSPGPRLQELLGPSPQ
RDPQTVKERALSAPWLSLFPPGGNMEDKELTGPQLPESLEDVAMYISQEEWGHQDPSKRA
LSRDTVQESYENVDPLESQVPSQEALSTQVEQGRKPWDPNVQICKEGLSPRSPAPGEEKF
ENLEESAQSVSLENIHTQALLPGQARGEAPWSLEQRRPQDRAEEHRGLPPEDRMEQSFVG
AASCRELGRPKELQPKKLHLCPLCGKNFSNNSNLMRHQRIHAAERLCLGVECAQIFGGNP
HFLSLHKAHLGEEAHKCLECGKSFSQNTHLTRHQRTHTGEKPYQCNVCGKSFSCNSNLHR
HQRTHTGEKPYKCPECGEIFAHSSNLLRHQRIHTGERPYKCAECGKSFSRSSHLVIHERT
HEKERLCPFSEGGQAVSDSSLFLTNHGTHKAEKKLFECLTCGKSFRQSMHLTRHQRTHTG
EKPYQCTLCGENFSHRSNLIRHQRIHTGEKPYTCQECGDSFSHSSNRIRHLRTHTGERPY
KCSQCGESFSRSSRLLSHQRTHTG
Download sequence
Identical sequences A0A287AS95
ENSSSCP00000008502 ENSSSCP00000008502 XP_013851174.1.46622 XP_013851175.1.46622 XP_013851177.1.46622 XP_020943756.1.46622 XP_020943757.1.46622 XP_020943758.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]