SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_021307166.1.57931 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_021307166.1.57931
Domain Number 1 Region: 63-161
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.18e-25
Family alpha-D-mannose-specific plant lectins 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_021307166.1.57931
Sequence length 184
Comment S-locus-specific glycoprotein S13 [Sorghum bicolor]; AA=GCF_000003195.3; RF=representative genome; TAX=4558; STAX=4558; NAME=Sorghum bicolor; cultivar=BTx623; AL=Chromosome; RT=Major
Sequence
MGFLPIHRIILLCFCSLLPPPVSSDSRLLPNKPLTVGSTLISDDGTFALGFFSPSNSTQK
HYFYVGIWYNKIPKDNVVWVANRATPVTDPSSATLALTNTSNLVLSSTNSQMLWTANISS
ASETTAGEATLDNTGNFILRTSEGVVLWQSFDYPADTLLPGMKFRVTHHWRTQYMDMGVQ
MYTQ
Download sequence
Identical sequences jgi|Sorbi1|5028853|Sb01g017420 4558.Sb01g017420.1 XP_021307165.1.57931 XP_021307166.1.57931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]