SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_021391915.1.53032 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_021391915.1.53032
Domain Number 1 Region: 9-114
Classification Level Classification E-value
Superfamily Nucleoplasmin-like core domain 6.93e-39
Family Nucleoplasmin-like core domain 0.0000781
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_021391915.1.53032
Sequence length 144
Comment nucleoplasmin-3 [Lonchura striata domestica]; AA=GCF_002197715.1; RF=representative genome; TAX=299123; STAX=40157; NAME=Lonchura striata domestica; AL=Scaffold; RT=Major
Sequence
MEPHGPACPGSVLFGCELTASTKSYTFQVDEEDDSDHILALSVVCLTDGAKDECNVVEVI
GRNHENQEITVPLANLKLSCQPLLSLDNFKLQPPVTFRLAAGSGPVHLAGWHKIMHREDA
SFEEDDDLSEEDEEDLPPIKPAKK
Download sequence
Identical sequences XP_021391915.1.53032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]