SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_021403106.1.53032 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_021403106.1.53032
Domain Number 1 Region: 254-324
Classification Level Classification E-value
Superfamily Homeodomain-like 2.1e-20
Family Homeodomain 0.0022
Further Details:      
 
Domain Number 2 Region: 97-165
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000618
Family LIM domain 0.014
Further Details:      
 
Domain Number 3 Region: 63-96
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000235
Family LIM domain 0.0076
Further Details:      
 
Weak hits

Sequence:  XP_021403106.1.53032
Domain Number - Region: 161-191
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00134
Family LIM domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_021403106.1.53032
Sequence length 397
Comment LIM/homeobox protein Lhx9 isoform X1 [Lonchura striata domestica]; AA=GCF_002197715.1; RF=representative genome; TAX=299123; STAX=40157; NAME=Lonchura striata domestica; AL=Scaffold; RT=Major
Sequence
MEIVGCRAEENTCPFRPPAMLFHGISGGHIQGIMEEMERRSKTESRLAKGGQMNGRDTNM
PPMSPEKPALCAGCGGKISDRYYLLAVDKQWHLRCLKCCECKLALESELTCFAKDGSIYC
KEDYYRRFSVQRCARCHLGISASEMVMRARESVYHLSCFTCTTCNKTLTTGDHFGMKDNL
VYCRAHFESLLQGEYPPQLSYTELAAKSGGLALPYFNGAGTVQKGRPRKRKSPALGVDIV
SYNSGCNENEADHLDRDQQPYPPSQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQL
AQKTGLTKRVLQVWFQNARAKFRRNLLRQENGGVDKADGTSLPAPPSADSGALTPPGTAT
TLTDLTNPTITVVTSVTSNLDSHESGSPSQTTLTNLF
Download sequence
Identical sequences H0Z1Q2
ENSTGUP00000004492 ENSTGUP00000004492 XP_012430549.1.42559 XP_021403106.1.53032 XP_021403114.1.53032 59729.ENSTGUP00000004492

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]